Goat Polyclonal Antibody against AKT3
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CSPTSQIDNIGEEEM, from the internal region of the protein sequence according to NP_005456; NP_859029. |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Goat Polyclonal Anti-POLDIP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POLDIP2 Antibody: Peptide with sequence KTHTYYQVLIDARDC, from the internal region of the protein sequence according to NP_056399.1. |
Goat Anti-IGF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1. |
Goat Polyclonal Antibody against GRB2
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRNYVTPVNRNV, from the C Terminus of the protein sequence according to NP_002077.1; NP_987102.1. |
Goat Polyclonal Antibody against p70S6K / RPS6KB1
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-MISKRPEHLRMNL, from the C Terminus of the protein sequence according to NP_003152.1. |
Goat Polyclonal Antibody against STAT3
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DMELTSECATSPM, from the C Terminus of the protein sequence according to NP_003141.2; NP_644805.1. |
Goat Anti-PRKAA2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2. |
Rabbit Polyclonal Anti-Erk1/2 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Sheep, Chicken, Drosophila, Xenopus, Cow |
| Conjugation | Unconjugated |
| Immunogen | A 35 residue synthetic peptide, corresponding to Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. |
Rabbit Polyclonal Antibody against VEGFA
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Goat Polyclonal Antibody against GRAP2 / GRID / Grf40
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GLFPANYVAPMTR, from the C Terminus of the protein sequence according to NP_004801.1. |
Goat Anti-TOMM40 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HTVALSTIGESNYH, from the internal region of the protein sequence according to NP_006105.1. |
Goat Anti-CADM1/TSLC1 Antibody
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLYTDPPQESYTT, from the internal region of the protein sequence according to NP_055148.3; NP_001091987.1. |
Goat Polyclonal Antibody against SCAP2 / PRAP
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GLVPKAYIMEMYDI, from the C Terminus of the protein sequence according to NP_003921.2. |
Germany
Japan
United Kingdom
China
