Dendritic Cells

cDNA Clones (11)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
IFNA5 (NM_002169) Human Tagged ORF Clone
RC210825

USD 300.00

In Stock

IFNA5 (Myc-DDK-tagged)-Human interferon, alpha 5 (IFNA5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
IFNA5 (NM_002169) Human Tagged ORF Clone Lentiviral Particle
RC210825L1V

USD 850.00

2 Weeks

Lenti ORF particles, IFNA5 (Myc-DDK tagged) - Human interferon, alpha 5 (IFNA5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

IFNA5 (NM_002169) Human Tagged ORF Clone Lentiviral Particle
RC210825L2V

USD 850.00

7 Weeks

Lenti ORF particles, IFNA5 (mGFP-tagged) - Human interferon, alpha 5 (IFNA5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

IFNA5 (NM_002169) Human Tagged ORF Clone Lentiviral Particle
RC210825L3V

USD 850.00

5 Weeks

Lenti ORF particles, IFNA5 (Myc-DDK tagged) - Human interferon, alpha 5 (IFNA5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

IFNA5 (NM_002169) Human Tagged ORF Clone Lentiviral Particle
RC210825L4V

USD 850.00

7 Weeks

Lenti ORF particles, IFNA5 (mGFP-tagged) - Human interferon, alpha 5 (IFNA5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

IFNA5 (NM_002169) Human Recombinant Protein
TP310825

USD 867.00

In Stock

Recombinant protein of human interferon, alpha 5 (IFNA5), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
IFNA5 (NM_002169) Human Tagged ORF Clone
RG210825

USD 500.00

In Stock

IFNA5 (tGFP-tagged) - Human interferon, alpha 5 (IFNA5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IFNA5 (NM_002169) Human Recombinant Protein
TP310825L

USD 9,200.00

6 Weeks

Recombinant protein of human interferon, alpha 5 (IFNA5), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
IFNA5 (NM_002169) Human Recombinant Protein
TP310825M

USD 2,950.00

6 Weeks

Recombinant protein of human interferon, alpha 5 (IFNA5), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
IFNA5 (NM_002169) Human Tagged Lenti ORF Clone
RC210825L2

USD 600.00

3 Weeks

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IFNA5 (NM_002169) Human Tagged Lenti ORF Clone
RC210825L3

USD 600.00

3 Weeks

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IFNA5 (NM_002169) Human Tagged Lenti ORF Clone
RC210825L4

USD 600.00

3 Weeks

Lenti ORF clone of Human interferon, alpha 5 (IFNA5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IFNA5 Rabbit Polyclonal Antibody
TA335047

USD 539.00

5 Days

Rabbit Polyclonal Anti-IFNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
IFNA5 (NM_002169) Human Over-expression Lysate
LC419486

USD 134.00

2 Weeks

IFNA5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T