JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,431.00
7 Weeks
Lenti ORF particles, JMJD7 (Myc-DDK tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,431.00
7 Weeks
Lenti ORF particles, JMJD7 (mGFP-tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Recombinant protein of human JMJD7-PLA2G4B readthrough transcript (JMJD7-PLA2G4B), transcript variant 1, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
JMJD7 (tGFP-tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human JMJD7-PLA2G4B readthrough transcript (JMJD7-PLA2G4B), transcript variant 1, 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Recombinant protein of human JMJD7-PLA2G4B readthrough transcript (JMJD7-PLA2G4B), transcript variant 1, 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
JMJD7 (tGFP-tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,449.00
8 Weeks
Lenti ORF particles, JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,449.00
8 Weeks
Lenti ORF particles, JMJD7 (mGFP-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Rabbit Polyclonal Anti-PLA2G4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD |
Rabbit Polyclonal Anti-PLA2G4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP |