Pro-B cell

View as table Download

JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, JMJD7 (Myc-DDK tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, JMJD7 (mGFP-tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Recombinant protein of human JMJD7-PLA2G4B readthrough transcript (JMJD7-PLA2G4B), transcript variant 1, 20 µg

Tag C-Myc/DDK
Expression Host HEK293T

JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

JMJD7 (tGFP-tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human JMJD7-PLA2G4B readthrough transcript (JMJD7-PLA2G4B), transcript variant 1, 1 mg

Tag C-Myc/DDK
Expression Host HEK293T

Recombinant protein of human JMJD7-PLA2G4B readthrough transcript (JMJD7-PLA2G4B), transcript variant 1, 100 µg

Tag C-Myc/DDK
Expression Host HEK293T

JMJD7 (tGFP-tagged) - Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, JMJD7 (mGFP-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Rabbit Polyclonal Anti-PLA2G4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD

Rabbit Polyclonal Anti-PLA2G4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP