Pro-B cell

View as table Download

IFNA16 (Myc-DDK-tagged)-Human interferon, alpha 16 (IFNA16)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, IFNA16 (Myc-DDK tagged) - Human interferon, alpha 16 (IFNA16), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, IFNA16 (mGFP-tagged) - Human interferon, alpha 16 (IFNA16), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, IFNA16 (Myc-DDK tagged) - Human interferon, alpha 16 (IFNA16), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, IFNA16 (mGFP-tagged) - Human interferon, alpha 16 (IFNA16), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

IFNA16 (tGFP-tagged) - Human interferon, alpha 16 (IFNA16)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interferon, alpha 16 (IFNA16), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 16 (IFNA16), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interferon, alpha 16 (IFNA16), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-IFNA16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNA16

Rabbit Polyclonal Anti-IFNA16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNA16 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA16. Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD

IFNA16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of interferon, alpha 16 (IFNA16)

Tag C-Myc/DDK
Expression Host HEK293T

IFNA16 (untagged)-Human interferon, alpha 16 (IFNA16)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin