PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLA2G5 (tGFP-tagged) - Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Rabbit Polyclonal Anti-PLA2G5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5. |
Rabbit Polyclonal Anti-PLA2G5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
PLA2G5 (untagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |