Pre-B cell

cDNA Clones (11)
Antibodies (3)
Jump to Filters
View as table Download
PLA2G5 (NM_000929) Human Tagged ORF Clone
RC207789

USD 225.00

In Stock

PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G5 (NM_000929) Human Tagged ORF Clone
RG207789

USD 425.00

3 Weeks

PLA2G5 (tGFP-tagged) - Human phospholipase A2, group V (PLA2G5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G5 (NM_000929) Human Tagged Lenti ORF Clone
RC207789L1

USD 525.00

In Stock

Lenti-ORF clone of PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PLA2G5 (NM_000929) Human Tagged Lenti ORF Clone
RC207789L2

USD 525.00

In Stock

Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PLA2G5 (NM_000929) Human Tagged ORF Clone Lentiviral Particle
RC207789L2V

USD 775.00

2 Weeks

Lenti ORF particles, PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G5 (NM_000929) Human Tagged ORF Clone Lentiviral Particle
RC207789L1V

USD 775.00

2 Weeks

Lenti ORF particles, PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G5 (NM_000929) Human Tagged ORF Clone Lentiviral Particle
RC207789L3V

USD 775.00

7 Weeks

Lenti ORF particles, PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G5 (NM_000929) Human Tagged ORF Clone Lentiviral Particle
RC207789L4V

USD 775.00

2 Weeks

Lenti ORF particles, PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G5 Rabbit Polyclonal Antibody
TA346054

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
PLA2G5 (C-term) Rabbit Polyclonal Antibody
AP53325PU-N

USD 580.00

2 Weeks

PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5.
PLA2G5 Rabbit Polyclonal Antibody
TA346053

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
PLA2G5 (NM_000929) Human Untagged Clone
SC119544

USD 889.00

In Stock

PLA2G5 (untagged)-Human phospholipase A2, group V (PLA2G5)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin