Pre-B cell

cDNA Clones (10)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
PLA2G4E (NM_001080490) Human Tagged ORF Clone
RC220690

USD 768.00

In Stock

PLA2G4E (Myc-DDK-tagged)-Human phospholipase A2, group IVE (PLA2G4E)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PLA2G4E (NM_001080490) Human Tagged ORF Clone Lentiviral Particle
RC220690L3V

USD 1,318.00

7 Weeks

Lenti ORF particles, PLA2G4E (Myc-DDK tagged) - Human phospholipase A2, group IVE (PLA2G4E), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G4E (NM_001080490) Human Tagged ORF Clone Lentiviral Particle
RC220690L4V

USD 1,318.00

7 Weeks

Lenti ORF particles, PLA2G4E (mGFP-tagged) - Human phospholipase A2, group IVE (PLA2G4E), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G4E (NM_001206670) Human Tagged ORF Clone
RG233152

USD 1,074.00

In Stock

PLA2G4E (tGFP-tagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G4E (NM_001080490) Human Tagged ORF Clone
RG220690

USD 968.00

In Stock

PLA2G4E (tGFP-tagged) - Human phospholipase A2, group IVE (PLA2G4E)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G4E (NM_001206670) Human Tagged ORF Clone
RC233152

USD 874.00

3 Weeks

PLA2G4E (Myc-DDK tagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G4E Rabbit Polyclonal Antibody
TA337645

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLA2G4E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT
PLA2G4E (NM_001080490) Human Tagged Lenti ORF Clone
RC220690L4

USD 1,068.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group IVE (PLA2G4E), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G4E (NM_001080490) Human Over-expression Lysate
LC421045

USD 206.00

In Stock

PLA2G4E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PLA2G4E (NM_001080490) Human Over-expression Lysate
LY421045

USD 665.00

2 Weeks

Transient overexpression lysate of phospholipase A2, group IVE (PLA2G4E)

Tag C-Myc/DDK
Expression Host HEK293T
PLA2G4E Rabbit Polyclonal Antibody
TA316069

USD 380.00

4 Weeks

Rabbit polyclonal anti-PLA2G4E antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E.
PLA2G4E (NM_001080490) Human Tagged Lenti ORF Clone
RC220690L3

USD 1,068.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group IVE (PLA2G4E), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G4E (NM_001080490) Human Untagged Clone
SC315840

USD 846.00

3 Weeks

PLA2G4E (untagged)-Human phospholipase A2, group IVE (PLA2G4E)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PLA2G4E (NM_001206670) Human Untagged Clone
SC329827

USD 875.00

4 Weeks

PLA2G4E (untagged) - Homo sapiens phospholipase A2, group IVE (PLA2G4E)

Vector pCMV6-Entry
Tag Tag Free
PLA2G4E CytoSection
TS420690P5

USD 1,174.00

4 Weeks

Transient overexpression of PLA2G4E in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Other Names FLJ45651; MGC126633; MGC126661
Accession Number NM_001080490, NP_001073959