Pre-B cell

cDNA Clones (11)
Antibodies (10)
Proteins (10)
Jump to Filters
View as table Download
HNF1 alpha (HNF1A) (NM_000545) Human Tagged ORF Clone Lentiviral Particle
RC211201L4V

USD 1,431.00

2 Weeks

Lenti ORF particles, HNF1A (mGFP-tagged) - Human HNF1 homeobox A (HNF1A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HNF1 alpha (HNF1A) (NM_000545) Human Tagged ORF Clone Lentiviral Particle
RC211201L1V

USD 1,431.00

2 Weeks

Lenti ORF particles, HNF1A (Myc-DDK tagged) - Human HNF1 homeobox A (HNF1A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HNF1 alpha (HNF1A) (NM_000545) Human Tagged ORF Clone Lentiviral Particle
RC211201L2V

USD 1,431.00

2 Weeks

Lenti ORF particles, HNF1A (mGFP-tagged) - Human HNF1 homeobox A (HNF1A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HNF1 alpha (HNF1A) (NM_000545) Human Tagged ORF Clone Lentiviral Particle
RC211201L3V

USD 1,431.00

2 Weeks

Lenti ORF particles, HNF1A (Myc-DDK tagged) - Human HNF1 homeobox A (HNF1A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein
TP311201

USD 867.00

In Stock

Recombinant protein of human HNF1 homeobox A (HNF1A), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
HNF1 alpha (HNF1A) (NM_000545) Human Tagged ORF Clone
RG211201

USD 1,081.00

In Stock

HNF1A (tGFP-tagged) - Human HNF1 homeobox A (HNF1A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein
TP311201M

USD 2,950.00

6 Weeks

Recombinant protein of human HNF1 homeobox A (HNF1A), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein
TP311201L

USD 9,200.00

6 Weeks

Recombinant protein of human HNF1 homeobox A (HNF1A), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
HNF1 alpha (HNF1A) (NM_000545) Human Untagged Clone
SC300093

USD 882.00

In Stock

HNF1A (untagged)-Human HNF1 homeobox A (HNF1A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA321150

USD 380.00

4 Weeks

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA321151

USD 380.00

4 Weeks

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A
HNF1 alpha (HNF1A) Rabbit Polyclonal Antibody
TA344549

USD 539.00

5 Days

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE