Germany
Japan
United Kingdom
China
Alzheimer’s Disease
View as table Download
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal BAX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal antibody to beta Amyloid (amyloid beta (A4) precursor protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Dog, Pig, Chimpanzee, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 602 and 770 of beta Amyloid (Uniprot ID#P05067) |
Rabbit polyclonal Amyloid β A4 (Phospho-Thr743/668) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Amyloid β A4 around the phosphorylation site of threonine 743 (A-V-TP-P-E) |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Clonalities
- Polyclonal
Families
- Transmembrane
Filter by
Target Symbol
Reactivities
Antibody Hosts
Conjugates
Modifications
Assay Types
Pathways
- Neurotrophin signaling pathway (28)
- Alzheimer's disease (26)
- Huntington's disease (21)
- Amyotrophic lateral sclerosis (ALS) (13)
- Apoptosis (13)
- Colorectal cancer (13)
- Pathways in cancer (13)
- Prion diseases (13)
- p53 signaling pathway (13)
- Notch signaling pathway (9)
- MAPK signaling pathway (8)
- Wnt signaling pathway (7)