ELISA Kits

Jump to Filters
View as table Download
BAX Rabbit Polyclonal Antibody
TA590174

USD 482.00

In Stock

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
TNF alpha (TNF) Mouse Monoclonal Capture Antibody [Clone ID: Mab1]
TA600026

USD 458.00

In Stock

TNF-A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026
AKT2 Rabbit Polyclonal Antibody
TA590729

USD 482.00

In Stock

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA590426

USD 482.00

In Stock

Rabbit Polyclonal Caspase 7 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
TNF alpha (TNF) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: Mab11]
TA700026

USD 494.00

In Stock

TNF-A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600026
AKT1 (C-term) Rabbit Polyclonal Antibody
AP22624SU-N

USD 575.00

2 Weeks

AKT1 (C-term) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, IP, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide.
TNFRSF1A Rabbit Polyclonal Antibody
TA328458

USD 314.00

In Stock

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
TNFRSF1A Mouse Monoclonal Capture Antibody [Clone ID: TBP]
TA600021

USD 458.00

In Stock

TNFRSF1A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700021
AKT1 Mouse Monoclonal Antibody [Clone ID: 17F6.B11]
TA319563

USD 590.00

5 Days

Mouse monoclonal Akt phospho S473 antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
TNFRSF1A Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: H398]
TA700021

USD 494.00

In Stock

TNFRSF1A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600021
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
AKT1 Mouse Monoclonal Capture Antibody [Clone ID: OTI2B9]
TA600055

USD 458.00

In Stock

AKT1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700055, TA700077
IRAK4 (2-13) Goat Polyclonal Antibody
AP23599PU-N

USD 500.00

2 Weeks

IRAK4 (2-13) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Bat, Equine
Conjugation Unconjugated
Immunogen Synthetic peptide from the N-terminus of human IRAK4 (NP_057207.2; NP_001107654.1)
AKT1 Mouse Monoclonal Antibody [Clone ID: 18F3.H11]
TA319561

USD 590.00

5 Days

Mouse monoclonal Akt phospho T308 antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated