Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 936 results

Page 1 of 63

(reset)

Galectin 3 (LGALS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]

TA801621BM

USD 509.00

In Stock

LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

CF801621

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

TA801621

USD 447.00

In Stock

LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Galectin 3 (LGALS3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]

TA801621AM

USD 509.00

2 Weeks

LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

TA801621S

USD 200.00

2 Days

LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SMOC2 Rabbit Polyclonal Antibody

TA351730

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-SMOC2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human SMOC2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ISG15 Rabbit Polyclonal Antibody

TA342596

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ISG15 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Prealbumin (TTR) Rabbit Polyclonal Antibody

TA321119

USD 380.00

4 Weeks

Anti-TTR Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CCN2 Rabbit Polyclonal Antibody

TA323092

USD 380.00

2 Weeks

Anti-CTGF Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 148-159 amino acids of Human Connective tissue growth factor

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IL1RAP Rabbit Polyclonal Antibody

TA324046

USD 380.00

2 Weeks

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NGF Rabbit Polyclonal Antibody

TA349414

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NGF Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NGF

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LIF Rabbit Polyclonal Antibody

TA321468

USD 380.00

2 Weeks

Anti-LIF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

EGFR Rabbit Polyclonal Antibody

TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

1 / 3

2 / 3

3 / 3

Previous Next

Cathelicidin (CAMP) Rabbit Polyclonal Antibody

TA306515

USD 570.00

2 Weeks

Rabbit Polyclonal Cathelicidin Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Cathelicidin antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Cathelicidin.

1 / 3

2 / 3

3 / 3

Previous Next

Laminin 5 (LAMB3) Rabbit Polyclonal Antibody

TA308917

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 15 of 936 results

Page 1 of 63