Antibodies

Jump to Filters
View as table Download
KCTD15 Mouse Monoclonal Antibody [Clone ID: AT4C3]
AM09364PU-N

USD 430.00

3 Weeks

KCTD15 mouse monoclonal antibody, clone AT4C3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated
KCTD15 Mouse Monoclonal Antibody [Clone ID: AT4C3]
AM09364PU-S

USD 315.00

3 Weeks

KCTD15 mouse monoclonal antibody, clone AT4C3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated
KCTD15 Rabbit Polyclonal Antibody
TA306747

USD 570.00

5 Days

Rabbit Polyclonal KCTD15 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCTD15 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human KCTD15.
KCTD15 Rabbit Polyclonal Antibody
TA338710

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCTD15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15. Synthetic peptide located within the following region: PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL