KCTD15 Rabbit Polyclonal Antibody

CAT#: TA338710

Rabbit Polyclonal Anti-KCTD15 Antibody

Product Images

WB Suggested Anti-KCTD15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15. Synthetic peptide located within the following region: PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: potassium channel tetramerization domain containing 15
• Database Link:
  NP_076981
  Entrez Gene 79047 Human
  UniProt ID Q96SI1
• Background: KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.
• Synonyms: MGC2628; MGC25497
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 91%

Reference Data

• Protein Families: Ion Channels: Other