Antibodies

Jump to Filters
View as table Download
CD51 (ITGAV) (C-term) Rabbit Polyclonal Antibody
AP31171PU-N

USD 535.00

2 Weeks

CD51 (ITGAV) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ITGAV antibody was raised against synthetic peptide
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA338302

USD 539.00

5 Days

Rabbit Polyclonal Anti-ITGAV Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA314095

USD 380.00

In Stock

Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGAV.
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA327266

USD 365.00

3 Weeks

ITGAV Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ITGAV
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA347895

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Integrin aV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV