Antibodies

Jump to Filters
View as table Download
ADAM17 Rabbit Polyclonal Antibody
TA305951

USD 570.00

2 Weeks

Rabbit Polyclonal TACE Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid.
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA590426

USD 482.00

In Stock

Rabbit Polyclonal Caspase 7 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
CD10 (MME) Rabbit Polyclonal Antibody
TA321228

USD 380.00

In Stock

Anti-MME Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase
ADAM17 Rabbit Polyclonal Antibody
TA321563

USD 380.00

In Stock

Anti-ADAM17 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA323199

USD 380.00

In Stock

Anti-CASP7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 207-303 amino acids of human caspase 7, apoptosis-related cysteine peptidase
Calpain 1 (CAPN1) Rabbit Polyclonal Antibody
TA324116

USD 380.00

In Stock

Anti-CAPN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit
BACE1 Rabbit Polyclonal Antibody
TA341892

USD 539.00

5 Days

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Rabbit Polyclonal Antibody
TA350583

USD 380.00

In Stock

Rabbit Polyclonal Anti-UQCRC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC1
UQCRC2 Rabbit Polyclonal Antibody
TA350584

USD 380.00

In Stock

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC2
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
TA322764

USD 380.00

4 Weeks

Anti-CASP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase
IDE Rabbit Polyclonal Antibody
TA323993

USD 380.00

4 Weeks

Anti-IDE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human insulin-degrading enzyme
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 570.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA321309

USD 380.00

In Stock

Anti-CASP9 (active) Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA323200

USD 380.00

In Stock

Anti-CASP7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 207-303 amino acids of human caspase 7, apoptosis-related cysteine peptidase
ADAM10 Rabbit Polyclonal Antibody
TA323231

USD 380.00

In Stock

Anti-ADAM10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human ADAM metallopeptidase domain 10