Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal FGF4 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
Goat Polyclonal Antibody against CD14
| Applications | FC, IHC, PEP-ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRVDADADPRQYAD, from the internal region of the protein sequence according to NP_000582.1. |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Partial recombaint protein |
Pro-EGF Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Internal region (near the N terminus) (SRQERVCNIEKNVS) |
Active filters
Reactivities
- Human
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Embryonic stem cells
Pathways
- Regulation of actin cytoskeleton