USD 447.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 447.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
SDHB mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 200.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
Applications | WB |
Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Anti-COX11 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 115-276 amino acids of human cytochrome c oxidase assembly homolog 11 (yeast) |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SDHB |
Rabbit polyclonal anti-COX17 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human COX17. |
Rabbit Polyclonal Anti-SDHA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SDHA |
ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-NDUFA4L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit polyclonal anti-ATP6V1H antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
ATP6AP1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Equine, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human ATP6AP1 |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |