Antibodies

View as table Download

FH (Fumarate Hydratase) mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)

Applications IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPT1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-OAT antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human OAT.

SGPL1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate lyase 1 protein.

CDw75 (ST6GAL1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 180-230 of Human CD75.

Rabbit Polyclonal GAPDH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH.

Rabbit anti-ALDH3A1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH3A1

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Anti-NME6 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

GAPDH mouse monoclonal antibody, clone 4G5

Applications ELISA, IF, WB
Reactivities Bovine, Feline, Goat, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against P4HA1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFARKDEPDAFKE, from the internal region of the protein sequence according to NP_000908.2; NP_001017962.1.

ATP6AP1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Equine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human ATP6AP1

Goat Polyclonal Antibody against PCK2 / PEPCK-M

Applications WB
Reactivities Human, Mouse, Rat, Guinea Pig (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2.

Chicken Polyclonal GAPDH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GAPDH antibody was raised against a 16 amino acid peptide from near the amino terminus of human GAPDH.

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C