Antibodies

View as table Download

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327)

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Rabbit polyclonal NRAS Antibody (N-term)

Applications FC, IF, WB
Reactivities Human (Predicted: Mouse, Rat, Chicken, Pig)
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS.

Goat Polyclonal Antibody against Flotillin 1

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794.

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)

Rabbit polyclonal NRAS Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Pig)
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-179 amino acids from the C-terminal region of human NRAS.

Goat Polyclonal Antibody against EXOC7

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNIKNDPDKEYN, from the internal region of the protein sequence according to NP_001013861.1; NP_056034.2.

Rabbit polyclonal antibody to SOCS4 (suppressor of cytokine signaling 4)

Applications IF, WB
Reactivities Human (Predicted: Pig, Chicken, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 376 and 440 of SOCS4 (Uniprot ID#Q8WXH5)

Goat Anti-PRKAA2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2.

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Rabbit, Xenopus)
Conjugation Unconjugated
Immunogen This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB).

Goat Polyclonal Antibody against SOCS3

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PIREFLDQYDAPL, from the C Terminus of the protein sequence according to NP_003946.3.

Goat Polyclonal Antibody against PCK2 / PEPCK-M

Applications WB
Reactivities Human, Mouse, Rat, Guinea Pig (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2.

Goat Polyclonal Antibody against SORBS1

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1.