Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, APC
| Applications | FC |
| Reactivities | Human |
| Conjugation | APC |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
SELPLG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELPLG |
Rabbit Polyclonal Anti-SELPLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF |
Rabbit Polyclonal Anti-SELPLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CD162
Families
- Druggable Genome
Pathways
- Cell adhesion molecules (CAMs)