Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Anti-SLC16A1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 486-500 amino acids of Human solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
Anti-SLC16A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 484-500 amino acids of Human solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Rabbit Polyclonal Antibody against XCT
Applications | FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal Nephrin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
ABCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit Polyclonal Antibody against GLUT1
Applications | ChIP, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |