Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
In Stock
LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-SMOC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMOC2 |
Rabbit monoclonal HSD17B13 Antibody,Clone OTIR3G2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ISG15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Anti-TTR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-CTGF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 148-159 amino acids of Human Connective tissue growth factor |
Anti-IL1RAP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein |
Anti-IL18 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal PON1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-AACT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin |