Antibodies

View as table Download

Anti-TNNI3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS

Rabbit Polyclonal Anti-MYL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3

Rabbit Polyclonal Anti-UQCRC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC1

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC2

Anti-TPM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-TPM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal CACNG6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6.

Rabbit Polyclonal Anti-CACNB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF

Rabbit Polyclonal Nhe-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1.

Rabbit Polyclonal Nhe-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1.

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

Rabbit polyclonal anti-ATP1A1(NaK ATPase) antibody, Loading control

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATP1A1

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE