Antibodies

View as table Download

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Rabbit polyclonal Collagen II antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen II.

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)

Rabbit Polyclonal Anti-GP1BA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GP1BA

Rabbit polyclonal Syndecan4 (Ab-179) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D).

Rabbit Polyclonal RHAMM Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHAMM antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human RHAMM.

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1

Rabbit Polyclonal Anti-ITGA2B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ITGA2B

Goat Anti-THBS1 Antibody

Applications FC, IF, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence NRIPESGGDNSVFD-C, from the N Terminus of the protein sequence according to NP_003237.2.

Rabbit Polyclonal Anti-ITGB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB3

Rabbit polyclonal anti-LAMB1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human LAMB1.

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Rabbit Polyclonal Anti-COMP Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human COMP