Antibodies

View as table Download

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

Rabbit Polyclonal LIM kinase 2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific

FGF23 Rabbit monoclonal antibody,clone OTIR5D11

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ITGB7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGB7

Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707)

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor