Germany
Japan
United Kingdom
China
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Rat, Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Antibodies
View as table Download
Rabbit Polyclonal GluR1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K). |
Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863 |
| Modifications | Phospho-specific |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
Rabbit Polyclonal NMDAR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the N-terminus of NMDAR2B of human origin |
Rabbit Polyclonal anti-GRIN2A Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIN2A |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Anti-NMDA NR2C Subunit Antibody
| Applications | WB |
| Reactivities | Rat, Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the N-terminal region of the NR2C subunit |
Anti-GRIN2B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1413-1425 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2B |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Active filters
Category
- Antibodies
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Ion Channels: Glutamate Receptors
Pathways
- Amyotrophic lateral sclerosis (ALS)