Antibodies

Jump to Filters
View as table Download
KEAP1 Rabbit Polyclonal Antibody
TA590238

USD 482.00

In Stock

Rabbit Polyclonal KEAP1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
BRCA1 Rabbit Polyclonal Antibody
TA310042

USD 565.00

In Stock

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).
ERCC8 Rabbit Polyclonal Antibody
TA329326

USD 539.00

5 Days

Rabbit Polyclonal anti-ERCC8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
TRIM32 Rabbit Polyclonal Antibody
TA323257

USD 380.00

In Stock

Anti-TRIM32 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32
TA323257 is a possible alternative to TA323256.
PML Protein (PML) Rabbit Polyclonal Antibody
TA314354

USD 380.00

In Stock

Rabbit polyclonal anti-PML antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PML.
PIAS2 Rabbit Polyclonal Antibody
TA339096

USD 485.00

5 Days

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: FLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDI
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 380.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
ERCC8 Rabbit Polyclonal Antibody
TA308521

USD 625.00

5 Days

Rabbit Polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 194 of CSA (Uniprot ID#Q13216)
MDM2 Rabbit Polyclonal Antibody
TA311995

USD 380.00

In Stock

Rabbit polyclonal anti-MDM2 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MDM2.
ELOC Rabbit Polyclonal Antibody
TA350487

USD 380.00

In Stock

Rabbit Polyclonal Anti-TCEB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
PIAS1 Rabbit Polyclonal Antibody
TA319754

USD 570.00

5 Days

Rabbit Polyclonal PIAS1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human PIAS1.
PIAS2 Rabbit Polyclonal Antibody
TA319767

USD 570.00

5 Days

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.
TRIM32 Rabbit Polyclonal Antibody
TA308451

USD 625.00

5 Days

Rabbit polyclonal antibody to TRIM32 (tripartite motif-containing 32)

Applications IF, WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 289 of TRIM32 (Uniprot ID#Q13049)
ERCC8 Rabbit Polyclonal Antibody
TA308479

USD 625.00

5 Days

Rabbit polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 330 of CSA (Uniprot ID#Q13216)
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA311668

USD 380.00

4 Weeks

Rabbit polyclonal anti-PIAS4 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS4.