Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against TARDBP
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Bat, Xenopus, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%). |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the C-terminus of human PPARD |
Rabbit Polyclonal anti-FOSL2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Zebrafish, Chicken, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit polyclonal CAF-1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
NAB1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NAB1 antibody: synthetic peptide directed towards the N terminal of human NAB1. |
Rabbit Polyclonal Antibody against MYC (T58)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine, Chicken, Pig, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC. |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Zebrafish, Rat, Mouse, Bovine, Chicken, X. tropicalis, Pig |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Active filters
Reactivities
- Zebrafish
Applications
- IHC
Families
- Transcription Factors
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Assay Types
Pathways
- Wnt signaling pathway (6)
- Pathways in cancer (5)
- Cell cycle (4)
- Colorectal cancer (4)
- Adherens junction (3)
- Chronic myeloid leukemia (3)
- TGF-beta signaling pathway (3)
- Acute myeloid leukemia (2)
- Cysteine and methionine metabolism (2)
- Endometrial cancer (2)
- Metabolic pathways (2)
- Pancreatic cancer (2)
- Proteasome (2)
- Thyroid cancer (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal cell carcinoma (1)
- Basal transcription factors (1)
- Bladder cancer (1)
- DNA replication (1)
- ErbB signaling pathway (1)
- Focal adhesion (1)
- Huntington's disease (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- MAPK signaling pathway (1)
- Melanogenesis (1)
- PPAR signaling pathway (1)
- Pathogenic Escherichia coli infection (1)
- Prostate cancer (1)
- RNA degradation (1)
- Small cell lung cancer (1)
- Tight junction (1)