Rabbit Polyclonal Anti-WNT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT3A |
Rabbit Polyclonal Anti-WNT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WNT3A |
Rabbit anti-AXIN2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AXIN2 |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Rabbit Polyclonal Anti-WNT8A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT8A |
AXIN2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | AXIN2 / Axin 2 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human AXIN2 |
WNT8A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gorilla, Human, Monkey, Gibbon, Horse (Predicted: Bovine, Dog) |
Conjugation | Unconjugated |
Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%). |