WNT3A Rabbit Polyclonal Antibody

CAT#: TA344190

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Product Images

WB Suggested Anti-WNT3A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

• 

  prostate

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: Wnt family member 3A
• Database Link:
  NP_149122
  Entrez Gene 89780 Human
  UniProt ID P56704
• Background: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• Synonyms: MGC119418; MGC119419; MGC119420
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Rat: 86%; Mouse: 86%; Dog: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
• Protein Pathways: Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway