Antibodies

Jump to Filters
Download
HSD17B13 Rabbit Monoclonal Antibody [Clone ID: OTIR5C10]
TA592047

USD 531.00

In Stock

Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10

Applications WB
Reactivities Human
Conjugation Unconjugated
Eotaxin 3 (CCL26) Rabbit Polyclonal Antibody
TA321741

USD 380.00

2 Weeks

Anti-CCL26 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human chemokine (C-C motif) ligand 26
SMOC2 Rabbit Polyclonal Antibody
TA351730

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-SMOC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMOC2
HSD17B13 Rabbit Monoclonal Antibody [Clone ID: OTIR3G2]
TA592045

USD 531.00

In Stock

Rabbit monoclonal HSD17B13 Antibody,Clone OTIR3G2

Applications WB
Reactivities Human
Conjugation Unconjugated
BDNF Rabbit Polyclonal Antibody
TA328615

USD 905.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).
ISG15 Rabbit Polyclonal Antibody
TA342596

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
Prealbumin (TTR) Rabbit Polyclonal Antibody
TA321119

USD 380.00

4 Weeks

Anti-TTR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
CD8A Rabbit Monoclonal Antibody [Clone ID: OTIR3D5]
TA592695

USD 379.00

2 Weeks

CD8 Rabbit monoclonal antibody,clone OTIR3D5

Applications IHC
Reactivities Human
Conjugation Unconjugated
SEMA3G (Center) Rabbit Polyclonal Antibody
AP53845PU-N

USD 580.00

2 Weeks

SEMA3G (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 216-244 amino acids from the Central region of Human SEMA3G
CCN2 Rabbit Polyclonal Antibody
TA323092

USD 380.00

2 Weeks

Anti-CTGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 148-159 amino acids of Human Connective tissue growth factor
LOX Rabbit Polyclonal Antibody
TA337077

USD 550.00

2 Weeks

Rabbit Polyclonal LOX Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen Within the range of amino acids 305-338 of human LOX protein were used as the immunogen.
IL1RAP Rabbit Polyclonal Antibody
TA324046

USD 380.00

2 Weeks

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein
IL18 Rabbit Polyclonal Antibody
TA324190

USD 380.00

2 Weeks

Anti-IL18 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
TA324190 is a possible alternative to TA324189.
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
AMH Rabbit Monoclonal Capture Antibody [Clone ID: OTIR5D9]
TA600549

USD 458.00

In Stock

AMH Capture Rabbit Monoclonal antibody,clone OTIR5D9

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700549