Antibodies

View as table Download

Rabbit Polyclonal Anti-ASAH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASAH2

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

Rabbit polyclonal anti-PHCA antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PHCA.

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

Rabbit Polyclonal Anti-ACER1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD

Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human Sphingomyelin Synthase 1 protein

UGT8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 373-401 amino acids from the Central region of human UGT8

Rabbit polyclonal anti-ASAH3L antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ASAH3L.

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL

Rabbit polyclonal antibody to GAL3ST1 (galactose-3-O-sulfotransferase 1)

Applications WB
Reactivities Human (Predicted: Mouse, Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 412 of GAL3ST1 (Uniprot ID#Q99999)

Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein

DEGS1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human DEGS1 protein

Sphingomyelin Synthase 2 (SGMS2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of Human SGMS2.

Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the mouse sphingomyelin synthase 1 protein

DEGS1 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human DEGS1 protein.