Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal antibody to NLK (nemo-like kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 234 and 527 of NLK (Uniprot ID#Q9UBE8) |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Rabbit Polyclonal anti-FOSL1 antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal SMAD2 Antibody
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, Bovine, Chicken, Drosophila, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2. |
Germany
Japan
United Kingdom
China
