Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal ATM Antibody
Applications | ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
Modifications | Phospho-specific |
Rabbit Polyclonal c-Myc Antibody
Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal MCM6 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
Rabbit Polyclonal anti-TP53 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
Applications | IF, IHC, IP, WB |
Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
Rabbit polyclonal anti-HDAC-1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Chicken, Pig) |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Anti-MCM4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 837-850 amino acids of Human minichromosome maintenance complex component 4 |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 469-482 amino acids of Human histone deacetylase 1 |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 469-482 amino acids of Human histone deacetylase 1 |