Germany
Japan
United Kingdom
China
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Anti-YWHAB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 72-87 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit Polyclonal CDKN2A Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Cell cycle
Filter by
Target Symbol
- P53 (36)
- CHK1 (18)
- SMAD3 (18)
- CDC25A (16)
- HDAC2 (16)
- CHK2 (14)
- GSK3 BETA (14)
- C-MYC (13)
- CYCLIN B1 (13)
- SMAD2 (13)
- HDAC1 (12)
- CDK1 (11)
- P16INK4A (11)
- RB (11)
- C ABL (10)
- CDC25B (9)
- CDK2 (9)
- CYCLIN A1 (9)
- CYCLIN D1 (9)
- CYCLIN E1 (9)
- MDM2 (9)
- PCNA (9)
- 14-3-3 BETA (8)
- P27 KIP 1 (8)
- APC1 (7)
- CDK7 (7)
- CYCLIN D3 (7)
- CYCLIN H (7)
- DP1 (7)
- E2F1 (7)
- MCM3 (7)
- P21 (7)
- SMAD4 (7)
- TGF BETA 1 (7)
- APC6 (6)
- CDC25C (6)
- CDC27 (6)
- CYCLIN A2 (6)
- DNA PKCS (6)
- E2F2 (6)
- EP300 (6)
- MAD2 (6)
- P18 INK4C (6)
- 14-3-3 EPSILON (5)
- 14-3-3 THETA (5)
- APC10 (5)
- BUB1 (5)
- CDC20 (5)
- CULLIN 1 (5)
- CYCLIN D2 (5)
- KAT3A / CBP (5)
- P15 INK4B (5)
- PLK1 (5)
- SMC1 (5)
- TGF BETA 2 (5)
- ATM (4)
- ATR (4)
- BUB3 (4)
- CDC2 (4)
- CDC23 (4)
- CDK6 (4)
- E2F4 (4)
- MCM2 (4)
- MPS1 (4)
- P57 KIP2 (4)
- PKMYT1 (4)
- RB2 P130 (4)
- SECURIN (4)
- SKP2 (4)
- 14 3 3 GAMMA (3)
- 14-3-3 SIGMA (3)
- APC5 (3)
- CDC7 (3)
- CYCLIN B2 (3)
- CYCLIN B3 (3)
- CYCLIN E2 (3)
- DP2 (3)
- MAD1 (3)
- RAD21 (3)
- SKP1 (3)
- 14 3 3 ETA (2)
- APC4 (2)
- APC7 (2)
- ARTEMIS (2)
- BUBR1 (2)
- CDC45L (2)
- CDK4 (2)
- DBF4 (2)
- E2F3 (2)
- E2F5 (2)
- GADD45A (2)
- GADD45B (2)
- ORC6L (2)
- P107 (2)
- P19 INK4D (2)
- SECURIN 2 (2)
- SMC3 (2)
- TGF BETA 3 (2)
- WEE1 (2)
- APC11 (1)