Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal FGF4 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal Anti-CTBP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Stem cell relevant signaling - Wnt Signaling pathway
Filter by
Category
Target Symbol
Modifications
Assay Types
Pathways
- Wnt signaling pathway (62)
- Pathways in cancer (59)
- Chronic myeloid leukemia (27)
- Basal cell carcinoma (24)
- Hedgehog signaling pathway (23)
- Melanogenesis (23)
- Colorectal cancer (21)
- Endometrial cancer (21)
- Acute myeloid leukemia (20)
- Bladder cancer (20)
- Cell cycle (20)
- Jak-STAT signaling pathway (20)
- Small cell lung cancer (20)
- Thyroid cancer (20)
- MAPK signaling pathway (19)
- Melanoma (17)
- ErbB signaling pathway (11)
- TGF-beta signaling pathway (11)
- Focal adhesion (9)
- Glioma (9)
- Non-small cell lung cancer (9)
- Pancreatic cancer (9)
- Prostate cancer (9)
- Viral myocarditis (9)
- p53 signaling pathway (9)
- Regulation of actin cytoskeleton (8)
- Notch signaling pathway (7)