Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
STAT6 Rabbit monoclonal antibody,clone UMAB300
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-STAT6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Active filters
Category
- Antibodies
Antibody Hosts
- Rabbit
Families
- Stem cell relevant signaling - DSL/Notch pathway
Filter by
Target Symbol
Reactivities
Applications
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (59)
- Jak-STAT signaling pathway (45)
- Chronic myeloid leukemia (41)
- Notch signaling pathway (39)
- Cell cycle (35)
- Acute myeloid leukemia (26)
- Prostate cancer (20)
- Small cell lung cancer (20)
- p53 signaling pathway (20)
- ErbB signaling pathway (15)
- Huntington's disease (15)
- ECM-receptor interaction (14)
- Hematopoietic cell lineage (14)
- Bladder cancer (11)
- Colorectal cancer (11)
- Endometrial cancer (11)
- Focal adhesion (11)
- Glioma (11)
- Melanoma (11)
- Non-small cell lung cancer (11)
- Pancreatic cancer (11)
- Thyroid cancer (11)
- Viral myocarditis (11)
- Wnt signaling pathway (11)
- Dorso-ventral axis formation (10)
- Prion diseases (10)
- Basal cell carcinoma (9)
- Hedgehog signaling pathway (9)
- Oocyte meiosis (9)
- Cytokine-cytokine receptor interaction (1)