Rabbit Polyclonal HIF-2 alpha Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Neuropeptide Y / NPY rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Amphibian, Birds, Fish, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Neuropeptide Y coupled to bovine thyroglobulin (BTg) with glutaraldehyde |
FMRF Amide (Cardio-excitatory Peptide) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Fish, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic FMRF-Amide coupled to bovine thyroglobulin (BTg) with FNPS. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human placental type IV Collagen. |
Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Human, Fish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
EIF3F (114-125) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Drosophila, Fish, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from aa 114-125 of human EIF3F |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Monkey, Dog, Xenopus, Rat, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Conjugation | Unconjugated |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
PROX1 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to the Homeobox domain of Prox1. |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Acetylcholinesterase rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Fish, Human |
| Conjugation | Unconjugated |
| Immunogen | Highly purified Acetylcholine Esterase from Electrophorus electricus. |
TAC1 rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Fish, Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Substance K / Neurokinin A (Peninsula) conjugated to BSA |
Germany
Japan
United Kingdom
China
