Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | ChIP, ICC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073) |
Germany
Japan
United Kingdom
China
