ATP6V0A2 Rabbit Polyclonal Antibody

CAT#: TA346466

Rabbit Polyclonal Anti-ATP6V0A2 Antibody

Product Images

ATP6V0A2 antibody - N-terminal region validated by WB using HeLa cells at 1: 300.

• 

  Application: Western blotting; Species+tissue/cell type: HeLa cells; How many ug'sof tissue/cell lysate run on the gel: 1. 10 ug untransfected HeLa lysate2. 10 ug mATP6V0A2 (Partial) transfected HeLa lysate3. 10 ug mATP6V0A2-FLAG transfected HeLa lysate4. 10 ug mATP6V0A1-FLAG transfected HeLa lysate; Primary antibody dilution: 1: 300; Secondary antibody: Anti-rabbit-HRP; Secondary antibody dilution: 1: 1000

• 

  Anti-ATP6V0A2 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Anti-ATP6V0A2 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody

• 

  Application: IHC/Immunofluorescence; Species+tissue/cell type: A. untransfected HeLa cellsB. mATP6V0A2-FLAG transfected HeLa cellsC. mATP6V0A2 (partial) transfected HeLa cells; Primary antibody dilution: 1: 250; Secondary antibody: Anti-rabbit AlexaFluor 488; Secondary antibody dilution: 1: 1000

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 98 kDa
• Gene Name: ATPase H+ transporting V0 subunit a2
• Database Link:
  NP_036595
  Entrez Gene 23545 Human
  UniProt ID Q9Y487
• Background: The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain (Smith et al., 2003 [PubMed 14580332]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: A2; ARCL; ARCL2A; ATP6A2; ATP6N1D; J6B7; RTF; STV1; TJ6; TJ6M; TJ6S; VPH1; WSS
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Bovine: 86%; Guinea pig: 83%; Yeast: 79%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection