Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2

Rabbit Polyclonal Anti-GYS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GYS1

Rabbit Polyclonal Anti-PYGL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PYGL

Rabbit Polyclonal Anti-PYGM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PYGM

AMY2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 77-105 amino acids from the N-terminal region of human AMY2B

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase

UGT2B15 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 163-193 amino acids from the Central region of human UGT2B15

Rabbit Polyclonal Antibody against PYGM (C-term)

Applications IHC, WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM.