Antibodies

Jump to Filters
View as table Download
beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody
AP51124PU-N

USD 580.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA350295

USD 380.00

In Stock

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA
HCLS1 Rabbit Polyclonal Antibody
TA329699

USD 539.00

5 Days

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
HCLS1 Rabbit Polyclonal Antibody
TA329700

USD 485.00

5 Days

Rabbit Polyclonal Anti-HCLS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA330025

USD 539.00

5 Days

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA330026

USD 485.00

5 Days

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA358331

USD 539.00

5 Days

PPP2CA Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA360182

USD 539.00

5 Days

PPP2CA Antibody - middle region

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PPP2CA
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313136

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.
PAR6 (PARD6A) Rabbit Polyclonal Antibody
TA323360

USD 380.00

In Stock

Anti-PARD6A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans)
DBPA (YBX3) Rabbit Polyclonal Antibody
TA330132

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-YBX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSDA antibody: synthetic peptide directed towards the N terminal of human CSDA. Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN
PP2A-alpha (PPP2CA) (N-term) Rabbit Polyclonal Antibody
AP15290PU-N

USD 580.00

2 Weeks

PP2A-alpha (PPP2CA) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide peptide between 1~30 amino acids from the N-terminal region of Human PPP2CA/B.
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
AP20705PU-N

USD 465.00

3 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PKC theta (PRKCQ) Rabbit Polyclonal Antibody
AP20760PU-N

USD 445.00

3 Weeks

PKC theta (PRKCQ) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PKC theta (PRKCQ) pSer676 Rabbit Polyclonal Antibody
AP20801PU-N

USD 495.00

3 Weeks

PKC theta (PRKCQ) pSer676 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated