Germany
Japan
United Kingdom
China
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal anti-ERCC8 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit polyclonal Cyclin H (Ab-315) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D). |
Rabbit polyclonal antibody to CSB (excision repair cross-complementing rodent repair deficiency, complementation group 6)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 346 and 766 of CSB (Uniprot ID#Q03468) |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Hamster, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Xenopus, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit Polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of CSA (Uniprot ID#Q13216) |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Nucleotide excision repair
Filter by
Category
Target Symbol
- RPA34 (11)
- CYCLIN H (10)
- ERCC8 (9)
- PCNA (8)
- CDK7 (7)
- DDB1 (7)
- GTF2H2 (7)
- POLD1 (7)
- GTF2H1 (6)
- DNA LIGASE I (5)
- GTF2H4 (5)
- RFC4 (5)
- MNAT1 (4)
- RFC2 (4)
- XPA (4)
- CENTRIN 2 (3)
- DDB2 (3)
- ERCC1 (3)
- RPA4 (3)
- RPA70 (3)
- XPB (3)
- XPF (3)
- XPG (3)
- CSB (2)
- GTF2H3 (2)
- HHR23A (2)
- HHR23B (2)
- XPC (2)
- ROC1 (1)
- RPA14 (1)
- XPD (1)