Antibodies

Jump to Filters
View as table Download
PGP9.5 (UCHL1) Rabbit Polyclonal Antibody
TA301477

USD 550.00

In Stock

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA312629

USD 380.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.
Cathepsin D (CTSD) Rabbit Polyclonal Antibody
TA590104

USD 482.00

In Stock

Rabbit Polyclonal Cathepsin D Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
MMP1 Rabbit Polyclonal Antibody
TA323955

USD 380.00

In Stock

Anti-MMP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase)
ADAMTS16 Rabbit Polyclonal Antibody
TA322059

USD 380.00

In Stock

Anti-ADAMTS16 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1076-1090 amino acids of human ADAM metallopeptidase with thrombospondin type 1 motif, 16
Matriptase 2 (TMPRSS6) Rabbit Polyclonal Antibody
TA337827

USD 539.00

In Stock

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
AGA Rabbit Polyclonal Antibody
TA323763

USD 380.00

In Stock

Anti-AGA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase
CD10 (MME) Rabbit Polyclonal Antibody
TA590055

USD 482.00

In Stock

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
MMP11 Rabbit Polyclonal Antibody
TA324103

USD 380.00

In Stock

Anti-MMP11 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 470-488 amino acids of Human matrix metallopeptidase 11 (stromelysin 3)
NAPSIN A (NAPSA) Rabbit Polyclonal Antibody
TA349495

USD 380.00

In Stock

Rabbit Polyclonal Anti-NAPSA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NAPSA
TMPRSS11E Rabbit Polyclonal Antibody
TA350522

USD 380.00

In Stock

Rabbit Polyclonal Anti-TMPRSS11E Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS11E
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA590426

USD 482.00

In Stock

Rabbit Polyclonal Caspase 7 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
CD10 (MME) Rabbit Polyclonal Antibody
TA321228

USD 380.00

In Stock

Anti-MME Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase
Cathepsin Z (CTSZ) Rabbit Polyclonal Antibody
TA321334

USD 380.00

In Stock

Anti-CTSZ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 62-303 amino acids of Human Cathepsin Z
ADAM17 Rabbit Polyclonal Antibody
TA321563

USD 380.00

In Stock

Anti-ADAM17 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein