Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
GFAP (K39) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | GFAP preparation from Human spinal cord. |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit polyclonal antibody to EML1 (echinoderm microtubule associated protein like 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 753 and 815 of EML1 (Uniprot ID#O00423) |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit polyclonal antibody to RAB6A (RAB6A, member RAS oncogene family)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 208 of RAB6A (Uniprot ID#P20340) |
Rabbit Polyclonal antibody to SEC13L1 (SEC13 homolog (S. cerevisiae))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 319 of SEC13L1 (Uniprot ID#P55735) |
Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Rat, Xenopus, Zebrafish, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7) |
Rabbit Polyclonal antibody to VPS35 (vacuolar protein sorting 35 homolog (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Zebrafish, Chicken, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 733 and 796 of VPS35 (Uniprot ID#Q96QK1) |
Germany
Japan
United Kingdom
China
