Primary Antibodies

Jump to Filters
View as table Download
SOCS1 Rabbit Polyclonal Antibody
TA321592

USD 380.00

4 Weeks

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1
SOCS1 Rabbit Polyclonal Antibody
TA321593

USD 380.00

In Stock

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1
SOCS1 Rabbit Polyclonal Antibody
TA346364

USD 485.00

5 Days

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA
SOCS1 Rabbit Polyclonal Antibody
TA890038

USD 407.00

In Stock

Rabbit polyclonal anti-SOCS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOCS1
SOCS1 Goat Polyclonal Antibody
TA302691

USD 520.00

In Stock

Goat Polyclonal Antibody against SOCS1

Applications FC, WB
Reactivities Mouse, Human (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-VLRDYLSSFPFQI, from the C Terminus of the protein sequence according to NP_003736.1.
SOCS1 Rabbit Polyclonal Antibody
TA890038S

USD 188.00

In Stock

Rabbit polyclonal anti-SOCS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOCS1

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SOCS1 (C-term) Rabbit Polyclonal Antibody
AP23370PU-N

USD 560.00

2 Weeks

SOCS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human SOCS1
SOCS1 Rabbit Polyclonal Antibody
TA306303

USD 570.00

2 Weeks

Rabbit Polyclonal SOCS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1.
SOCS1 Rabbit Polyclonal Antibody
AP20630PU-N

USD 445.00

3 Weeks

SOCS1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SOCS1 Rabbit Polyclonal Antibody
TA346365

USD 539.00

5 Days

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
SOCS1 Rabbit Polyclonal Antibody
TA354506

USD 370.00

5 Days

Rabbit anti SOCS1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of SOCS-1 protein from human and mouse origins.