Primary Antibodies

View as table Download

Rabbit polyclonal ATG5 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Pig)
Conjugation Unconjugated
Immunogen This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5.

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Rabbit polyclonal PI3KC3 Antibody (S34)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Pig, Xenopus)
Conjugation Unconjugated
Immunogen This PI3KC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-39 amino acids from human PI3KC3.

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL