TAC1 rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
TAC1 rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TAC1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TAC1 |
Rabbit Polyclonal Anti-TAC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |
Anti-TAC1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 58-68 amino acids of Human tachykinin, precursor 1 |
TAC1 rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian, Rat |
Conjugation | Unconjugated |
TAC1 guinea pig polyclonal antibody, Serum
Applications | FC, IHC |
Reactivities | Fish, Human, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Substance P conjugated to BSA |
TAC1 rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Fish, Human, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Substance K / Neurokinin A (Peninsula) conjugated to BSA |