TAC1 Rabbit Polyclonal Antibody

CAT#: TA342648

Rabbit Polyclonal Anti-TAC1 Antibody

Product Images

WB Suggested Anti-TAC1 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: tachykinin precursor 1
• Database Link:
  NP_054703
  Entrez Gene 6863 Human
  UniProt ID P20366
• Background: This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: Hs.2563; NK2; NKNA; NPK; TAC2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 92%; Bovine: 92%; Mouse: 85%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein