Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Rabbit polyclonal GLS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2. |
Rabbit Polyclonal Anti-GLS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF |
Rabbit Polyclonal Anti-GLS Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT |
GLUD1 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey, Mouse, Pig, Gibbon, Horse, Orang-Utan (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Rabbit Polyclonal Anti-GLUD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR |
Rabbit Polyclonal Anti-GLUD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF |
Germany
Japan
United Kingdom
China
