Germany
Japan
United Kingdom
China
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
| Applications | WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Primary Antibodies
View as table DownloadMouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Dog |
| Conjugation | Unconjugated |
Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal Anti-TJP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS |
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Vibrio cholerae infection
Citations
- Yes